API Documentation
    Setup

    Overview

    Overview and rate limits

    API Key

    Setup and limits

    MCP Server

    Connect AI assistants to Tamarind tools
    GET

    /tools

    View available tools and configurations
    Submit Jobs
    POST

    /submit-job

    Submit individual jobs
    POST

    /submit-batch

    Submit multiple jobs
    Finetuning
    GET

    /finetuned-models

    List available finetuned models
    Job Management
    GET

    /jobs

    List and inspect jobs
    POST

    /result

    Download job results
    DELETE

    /delete-job

    Delete jobs and associated data
    POST

    /stop-job

    Stop running or queued jobs
    File Management
    PUT

    /upload/{filename}

    Upload files to your account
    GET

    /files

    List and organize files
    DELETE

    /delete-file

    Remove files from your account
    Pipelines
    POST

    /run-pipeline

    Run saved pipelines
    POST

    /submit-pipeline

    Create new pipelines

Submit Single Jobs

The POST API endpoint /submit-job allows users to submit jobs to Tamarind. These jobs are visible in the same queue as jobs submitted through the UI. You may choose your job type and settings below to configure your job.

Options for inputting file fields (ex. .pdb, .sdf, etc.):

  • Use the /upload endpoint and upload your file before submitting
  • Use the path of a previous Tamarind job, in the format JobName/path/to/file.ext
  • Submit the contents of your file directly

Select tool:

Settings

Protein amino acid sequence, use : to separate chains for multimers

Options: ["1", "2", "3", "4", "5"]

Default: 5

Number of Models: Number of models to be used, each generating a different prediction

Default: 3

Number of recycles: Number of times to recycle outputs back through structure prediction process for refined results

Default: 0

Number of models to relax: Number of models to perform amber relaxation for more accurate side chain predictions

Default: True

Use Multiple Sequence Alignment: When MSAs are disabled, AlphaFold will run in single sequence mode.

Options: ["paired", "unpaired", "unpaired_paired"]

Pair Mode: "unpaired_paired" = pair sequences from same species + unpaired MSA, "unpaired" = seperate MSA for each chain, "paired" - only use paired sequences.

Options: ["uniref", "swissprot", "uniref+swissprot"]

Default: uniref

MSA Database: Select how the MSA is generated using UniRef30, SwissProt, and the ColabFold environmental database.

Options: ["pdb100", "custom", "none"]

Default: pdb100

Template Mode: Choose which template mode to use for your prediction

Custom Template Files: Use custom structural templates in your prediction

Initial Guess Structure: Optional PDB/CIF whose atom positions seed the prediction instead of a random starting model (ColabFold --initial-guess). Useful for refining a known or designed structure.

Random seed: Random seed to be used in structure prediction

Options: ["508:2048", "512:1024", "256:512", "128:256", "64:128", "32:64", "16:32"]

Max MSA: Max # Clusters : Max # Extra Sequences - decrease max_msa to increase uncertainity

Options: ["0.0", "0.5", "1.0"]

Recycle Early Stop Tolerance: Run recycles until distance between recycles is within a given tolerance (0 = never stop early)

Default: False

Score with IPSAE: Use IPSAE scoring function for interprotein interactions

Default: False

Options: ["auto", "alphafold2_ptm", "alphafold2_multimer_v1", "alphafold2_multimer_v2", "alphafold2_multimer_v3", "deepfold_v1", "alphafold2"]

Default: auto

Model Type: Model type to be used. If auto selected, will use alphafold2_ptm for monomer prediction and alphafold2_multimer_v3 for complex prediction (recommended canonical weights). Any of the mode_types can be used (regardless if input is monomer or complex)

HTTP Response Status Codes
Status codeDescription
200Job successfully submitted
400Bad request
403Forbidden - organization or team budget exceeded
500Internal server error
1import requests
2
3api_key = "***************"
4headers = {'x-api-key': api_key}
5base_url = "https://app.tamarind.bio/api/"
6
7params = {
8  "jobName": "myJobName",
9  "type": "alphafold",
10  "settings": {
11    "sequence": "MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV"
12  }
13}
14response = requests.post(base_url + "submit-job", headers=headers, json=params)
15print(response.text)
Response Format
myJobName submitted to queue.
Optional Parameters:

projectTag

= "proj_..."

Assign the job to a project by its ProjectId