API Documentation

Submit Batch Jobs

POST/api/submit-batch

The POST API endpoint /submit-batch allows users to submit multiple jobs of the same tool associated together in a batch. You may choose your job type and specify the settings of each individual job within the batch to configure your batch.

Select tool:

Settings

Protein amino acid sequence, use : to separate chains for multimers

Options: ["1", "2", "3", "4", "5"]

Default: 5

Number of Models: Number of models to be used, each generating a different prediction

Default: 3

Number of recycles: Number of times to recycle outputs back through structure prediction process for refined results

Default: 0

Number of models to relax: Number of models to perform amber relaxation for more accurate side chain predictions

Default: True

Use Multiple Sequence Alignment: When MSAs are disabled, AlphaFold will run in single sequence mode.

Options: ["paired", "unpaired", "unpaired_paired"]

Pair Mode: "unpaired_paired" = pair sequences from same species + unpaired MSA, "unpaired" = separate MSA for each chain, "paired" - only use paired sequences.

useMSA must be true for this setting to be used

Options: ["pdb100", "custom", "none"]

Default: pdb100

Template Mode: Choose which template mode to use for your prediction

Custom Template File: One structural template for the prediction (.cif or .pdb). Wire a single structure, or upload one file.

templateMode must be custom for this setting to be used

Initial Guess Structure: Optional PDB/CIF whose atom positions seed the prediction instead of a random starting model (ColabFold --initial-guess). Useful for refining a known or designed structure.

Random seed: Random seed to be used in structure prediction

Options: ["508:2048", "512:1024", "256:512", "128:256", "64:128", "32:64", "16:32"]

Max MSA: Max # Clusters : Max # Extra Sequences - decrease max_msa to increase uncertainty

useMSA must be true for this setting to be used

Options: ["0.0", "0.5", "1.0"]

Recycle Early Stop Tolerance: Run recycles until distance between recycles is within a given tolerance (0 = never stop early)

Default: False

Score with IPSAE: Use IPSAE scoring function for interprotein interactions

Default: False

Options: ["auto", "alphafold2_ptm", "alphafold2_multimer_v1", "alphafold2_multimer_v2", "alphafold2_multimer_v3", "deepfold_v1", "alphafold2"]

Default: auto

Model Type: Model type to be used. If auto selected, will use alphafold2_ptm for monomer prediction and alphafold2_multimer_v3 for complex prediction (recommended canonical weights). Any of the mode_types can be used (regardless if input is monomer or complex)

HTTP Response Status Codes
Status codeDescription
200Batch successfully submitted
400Bad request
403Forbidden - organization or team budget exceeded
500Internal server error
1import requests
2
3api_key = "***************"
4headers = {'x-api-key': api_key}
5base_url = "https://app.tamarind.bio/api/"
6
7params = {
8  "batchName": "myBatchName",
9  "type": "alphafold",
10  "settings": [
11    {
12      "sequence": "MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV"
13    }, {
14      "sequence": "MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV"
15    }, ...
16  ],
17  "jobNames": ["job1", "job2"...]
18}
19response = requests.post(base_url + "submit-batch", headers=headers, json=params)
20print(response.text)
Response Format
myBatchName batch submitted to queue.
Optional Parameters:

projectTag

= "proj_..."

Assign all jobs in the batch to a project by its ProjectId